PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00074366001
Common NameGSBRNA2T00074366001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 232aa    MW: 26542 Da    PI: 7.8369
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00074366001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.91.1e-332377155
              G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         kprl+Wt eLHerFv+av++LGG++kAtPkti+++m vkgLtl+h+kSHLQk+Rl
  GSBRNA2T00074366001 23 KPRLCWTAELHERFVDAVTHLGGPDKATPKTIMRVMAVKGLTLYHLKSHLQKFRL 77
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.8032080IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-312078IPR009057Homeodomain-like
SuperFamilySSF466891.18E-162278IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-242378IPR006447Myb domain, plants
PfamPF002492.3E-62675IPR001005SANT/Myb domain
PfamPF143792.6E-14133173IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MMQSREERRA ESPSGLVLTT DPKPRLCWTA ELHERFVDAV THLGGPDKAT PKTIMRVMAV  60
KGLTLYHLKS HLQKFRLGKQ PHNEHSHGHS TNIRDTNRVV NRHRSITHAA SMLDLQRNVV  120
FSTPHIIGRN MNEMQMEVKR RIEEEVEVER QVNQRIEAQG KYMESMLEKA CETQEASLTK  180
DYSTLFFNNT SPLPIPWFED HFPSSSSMDS TLNLSDISLN FSLQDSRSSI S*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00074366001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893351e-160AC189335.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB039A19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013585190.11e-174PREDICTED: myb family transcription factor APL isoform X1
SwissprotQ9SAK59e-69APL_ARATH; Myb family transcription factor APL
TrEMBLA0A078HZI91e-174A0A078HZI9_BRANA; BnaC05g40460D protein
TrEMBLA0A0D3CKT21e-174A0A0D3CKT2_BRAOL; Uncharacterized protein
STRINGBra039340.1-P1e-139(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM137451726
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12730.11e-110G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]